top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr3|33573109|33632371|-|18|circRNA|CLASP2|ENST00000399362.8|26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9 | circCLASP2(26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9) | CLASP2 | LVRKERRPPRSAELIKKSENTKVLLRKEVLEQLMKMIL | EVLEQLMK | No | Alternative | Junction | 8 | 3 | TTG | TAA | TransCirc | No |
chr3|37294978|37302332|+|5|circRNA|GOLGA4|ENST00000361924.6|6,7,8,9,10 | circGOLGA4(6,7,8,9,10) | GOLGA4 | MVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERAGAPNGPAGKETSARGV | AGAPNGPAGKETSAR | No | Junction | Junction | 15 | 1 | ATG | TGA | TransCirc | No |
chr3|37323587|37329093|+|3|circRNA|GOLGA4|ENST00000361924.6|14,15,16 | circGOLGA4(14,15,16) | GOLGA4 | LKGNSSRHLLSWTFFSLTRVPHMSRQKHMRNSWPNCSRSCWIWKQKEFFLPNRLLKLKHKRKMFVLS | LKGNSSR | No | Alternative | Alternative | 7 | 1 | CTG | TAG | NA | No |
chr3|37323587|37329093|+|3|circRNA|GOLGA4|ENST00000361924.6|14,15,16 | circGOLGA4(14,15,16) | GOLGA4 | LRFIDENSMMSYQSGKRNLISKLKNFRKYMKSNYRKKNKR | LRFIDENSMMSYQSGK | No | Alternative | Alternative | 16 | 1 | CTG | TAG | NA | No |
chr3|37329093|37334981|+|1|ciRNA|GOLGA4|ENST00000361924.6|16 | ciGOLGA4(16) | GOLGA4 | MENSLLPGQSRQERTICMPNFISRNIGSVSHILLFLIQPRLFFAV | MENSLLPGQSR | No | Alternative | Alternative | 11 | 1 | ATG | TGA | NA | No |
Page 1 of 1
bottom of page