top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr3|194604286|194617269|-|4|circRNA|TMEM44|ENST00000392432.6|10,9,8,7 | circTMEM44(10,9,8,7).A | TMEM44 | MRPCRTPRRTLPFRSSGPGCLPAAPLRSPPSTPTWSAGGRHFPPSTCGPGSCRPWLASSMPRPLWPTTSTLSTCCGPHPGS | SSGPGCLPAAPLRSPPSTPTWSAGGR | No | Junction | Junction | 26 | 2 | ATG | TGA | TransCirc | No |
chr3|194646163|194665643|-|8|circRNA|LSG1|ENST00000265245.9|12,11,10,9,8,7,6,5 | circLSG1(12,11,10,9,8,7,6,5) | LSG1 | MRGFMTAHGQPDQPRSARYILKDYVSARRGTEADIDSI | GTEADIDSI | No | Alternative | Junction | 9 | 3 | ATG | TGA | TransCirc | No |
chr3|195872275|195879175|-|4|circRNA|TNK2|NM_001308046|10,9,8,7 | circTNK2(10,9,8,7) | TNK2 | LVAWPEHTDAVCGALPSQRGDLRGRPVGPGHQPAPAEQLHPHRAWRQ | LVAWPEHTDAVCGALPSQR | No | Alternative | Alternative | 19 | 1 | CTG | TGA | TransCirc | No |
chr3|195878252|195888606|-|8|circRNA|TNK2|NM_001308046|9,8,7,6,5,4,3,2 | circTNK2(9,8,7,6,5,4,3,2) | TNK2 | MMSSPSSREEAGRRQNAARGGHRLAAGAAVRGAAATVLPAAPR | LAAGAAVR | No | Alternative | Junction | 8 | 2 | ATG | TGA | riboCIRC,TransCirc | No |
chr3|195984311|195985626|-|1|ciRNA|SDHAP1|ENST00000413474.5|3 | ciSDHAP1(3) | SDHAP1 | LAFSESPSGWIWAWKTKLGFLFVACKEWLVFPGWNQCCSGEHGGGQLEVAFL | TKLGFLFVACK | No | Alternative | Alternative | 11 | 1 | TTG | TGA | NA | No |
Page 1 of 1
bottom of page