top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|74239937|74249220|-|4|circRNA|RFC2|NM_001278791|7,6,5,4 | circRFC2(7,6,5,4) | RFC2 | LKSLLEISFPGPSRNRQDHKHSVLGPGPAGPSTQRCHVGTQCFK | SLLEISFPGPSR | No | Alternative | Alternative | 12 | 2 | TTG | TGA | NA | No |
chr7|74317479|74354004|+|3|circRNA|CLIP2|ENST00000361545.9|2,3,4 | circCLIP2(2,3,4) | CLIP2 | LAGRRLAWCGTWGRQTLPRASGVAWSWTSPLGRMMGRWRAPGE | ASGVAWSWTSPLGR | No | Alternative | Junction | 14 | 2 | TTG | TGA | TransCirc | No |
chr7|74317479|74354004|+|3|circRNA|CLIP2|ENST00000361545.9|2,3,4 | circCLIP2(2,3,4) | CLIP2 | LAGRRLAWCGTWGRQTLPRASGVAWSWTSPLGRMMGRWRAPGE | ASGVAWSWTSPLGRMMGR | No | Alternative | Junction | 18 | 2 | TTG | TGA | TransCirc | No |
chr7|74317479|74354004|+|3|circRNA|CLIP2|ENST00000361545.9|2,3,4 | circCLIP2(2,3,4) | CLIP2 | LAGRRLAWCGTWGRQTLPRASGVAWSWTSPLGRMMGRWRAPGE | LAWCGTWGRQTLPR | No | Alternative | Junction | 14 | 2 | TTG | TGA | TransCirc | No |
chr7|74317479|74354004|+|3|circRNA|CLIP2|ENST00000361545.9|2,3,4 | circCLIP2(2,3,4) | CLIP2 | LAGRRLAWCGTWGRQTLPRASGVAWSWTSPLGRMMGRWRAPGE | QTLPRASGVAWSWTSPLGR | No | Alternative | Junction | 19 | 2 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page