top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr22|50516548|50517394|+|1|ciRNA|NCAPH2|NM_014551|2 | ciNCAPH2(2) | NCAPH2 | LRIIFGTKIGGFLYWRFGGGGQASWGHRWIAGKALGVGPSFVGPA | ALGVGPSFVGPA | No | Junction | Junction | 12 | 1 | TTG | TGA | NA | No |
chr22|50684584|50722437|+|13|circRNA|SHANK3|ENST00000414786.6|9,10,11,12,13,14,15,16,17,18,19,20,21 | circSHANK3(9,10,11,12,13,14,15,16,17,18,19,20,21) | SHANK3 | LASSLCTPPATGRSPAGWGGPKRSARAPRSWPRPPCSQRLWQSPCPAPGPSPLVAPRQTPGQARAAQRKSQSWCLL | SPAGWGGPKR | No | Alternative | Alternative | 10 | 1 | CTG | TGA | TransCirc | No |
chr22|50684584|50722437|+|13|circRNA|SHANK3|ENST00000414786.6|9,10,11,12,13,14,15,16,17,18,19,20,21 | circSHANK3(9,10,11,12,13,14,15,16,17,18,19,20,21) | SHANK3 | LDSCACSQGGREGPPGGAEVTRGQEVHDPQRPGHIPAAASWPHRCARHQQRAGAQQAGGGRRGAPGHPGVGPGPHAVSGCGRAPAQPPGPAPWWHPGRRRARPGQLRGRARAGVCCEPATCPAVVQR | AGAQQAGGGR | No | Alternative | Alternative | 10 | 2 | CTG | TGA | TransCirc | No |
chr3|100295086|100302237|+|6|circRNA|TBC1D23|NM_001199198|6,7,8,9,10,11 | circTBC1D23(6,7,8,9,10,11) | TBC1D23 | LFYGQWQGGRRHVYEHGPGTLFTAWKSFCMLLFH | HVYEHGPGTLFTAWK | No | Junction | Junction | 15 | 3 | CTG | TGA | TransCirc | No |
chr3|100295086|100302237|+|6|circRNA|TBC1D23|NM_001199198|6,7,8,9,10,11 | circTBC1D23(6,7,8,9,10,11) | TBC1D23 | LFYGQWQGGRRHVYEHGPGTLFTAWKSFCMLLFH | HVYEHGPGTLFTAWKSFCMLLFH | No | Junction | Junction | 23 | 3 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page