top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr22|43046409|43079986|-|9|circRNA|TTLL1|NM_012263|10,9,8,7,6,5,4,3,2 | circTTLL1(10,9,8,7,6,5,4,3,2) | TTLL1 | MTPSTSPSRMVKSQTANGTSRHLRKSSAITRFWKKEGPASVTSARPR | KEGPASVTSARPR | No | Alternative | Junction | 13 | 2 | ATG | TGA | TransCirc | No |
chr22|43667103|43765393|-|13|circRNA|EFCAB6|ENST00000396231.6|15,14,13,12,11,10,9,8,7,6,5,4,3 | circEFCAB6(15,14,13,12,11,10,9,8,7,6,5,4,3) | EFCAB6 | LKNSKSVYSSRTRHSKNDFLTSARSLMEKLTCMTLRRSPLAPLVLYRTLPFCPGLVELTYI | SLMEKLTCMTLR | No | Alternative | Junction | 12 | 3 | TTG | TAA | TransCirc | No |
chr22|45322370|45323427|+|2|circRNA|FAM118A|ENST00000216214.7|3,4 | circFAM118A(3,4) | FAM118A | LASAQQWPPESLPFARGEAASRPSSRLQSSWRCCTPETSPSSGGK | CCTPETSPSSGGK | No | Alternative | Alternative | 13 | 3 | CTG | TGA | TransCirc | No |
chr22|46215172|46220014|+|3|circRNA|PPARA|ENST00000262735.9|4,5,6 | circPPARA(4,5,6) | PPARA | MPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPTRFHQLRAPPR | VILSGKASNNPTR | No | Junction | Junction | 13 | 3 | ATG | TGA | TransCirc | No |
chr22|46312140|46326654|+|5|circRNA|GTSE1|ENST00000454366.1|5,6,7,8,9 | circGTSE1(5,6,7,8,9) | GTSE1 | MACVSLAHTRQPALLWPSTDDPQNDAQGRGLSPVCASSETFL | GLSPVCASSETFL | No | Alternative | Alternative | 13 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page