top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr22|41254307|41258106|-|5|circRNA|RANGAP1|NM_001278651|12,11,10,9,8 | circRANGAP1(12,11,10,9,8) | RANGAP1 | LGSSGPWRRSTCHRMGSTTLASLPWPRLSLSTPCCGSST | LGSSGPWRR | No | Junction | Junction | 9 | 3 | CTG | TGA | TransCirc | No |
chr22|41254307|41258106|-|5|circRNA|RANGAP1|NM_001278651|12,11,10,9,8 | circRANGAP1(12,11,10,9,8) | RANGAP1 | LGSSGPWRRSTCHRMGSTTLASLPWPRLSLSTPCCGSST | MGSTTLASLPWPRLSLSTPCCGSST | No | Alternative | Junction | 25 | 3 | CTG | TGA | TransCirc | No |
chr22|41320654|41327364|+|4|circRNA|ZC3H7B|NM_017590|2,3,4,5 | circZC3H7B(2,3,4,5) | ZC3H7B | MRRRWRTARRRWAWTVRVSGRCSARHALSMNWDATRRPTSAAAGVPSPCPTD | HALSMNWDATR | No | Alternative | Junction | 11 | 2 | ATG | TGA | TransCirc | No |
chr22|41873797|41894937|+|10|circRNA|SREBF2|ENST00000612482.4|5,6,7,8,9,10,11,12,13,14 | circSREBF2(5,6,7,8,9,10,11,12,13,14) | SREBF2 | LGESSSLSPPKKEKGGQPIISLRNDIAPPSMTKSSN | GGQPIISLRNDIAPPSMTK | No | Alternative | Alternative | 19 | 3 | CTG | TGA | TransCirc | No |
chr22|41893116|41903155|+|6|circRNA|SREBF2|ENST00000612482.4|13,14,15,16,17,18 | circSREBF2(13,14,15,16,17,18) | SREBF2 | LWGRPTTRQALNWRASNGTWAACAGWHTASAQHTARATSSAEPRACVAPSTVLFLTPCAGSATPWARSFSWSGAGL | ASNGTWAACAGWHTASAQHTARATSSAEPR | No | Junction | Junction | 30 | 2 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page