top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr22|39415005|39419630|+|6|circRNA|TAB1|ENST00000216160.10|2,3,4,5,6,7 | circTAB1(2,3,4,5,6,7) | TAB1 | MLERSSRWGSSVGRRAPGGSGITRLNMATRTLTFSGAAAKLDR | SSRWGSSVGR | No | Alternative | Junction | 10 | 1 | ATG | TGA | TransCirc | No |
chr22|39415005|39419630|+|6|circRNA|TAB1|ENST00000216160.10|2,3,4,5,6,7 | circTAB1(2,3,4,5,6,7) | TAB1 | MLERSSRWGSSVGRRAPGGSGITRLNMATRTLTFSGAAAKLDR | WGSSVGRR | No | Alternative | Junction | 8 | 1 | ATG | TGA | TransCirc | No |
chr22|40246014|40270280|+|4|circRNA|TNRC6B|ENST00000301923.13|5,6,7,8 | circTNRC6B(5,6,7,8) | TNRC6B | LLQIMVLPLGVSQMKAVLGGARWMIQEHRPQAGGTRPPTLPMP | AVLGGAR | No | Alternative | Alternative | 7 | 1 | CTG | TGA | NA | No |
chr22|40246014|40270280|+|4|circRNA|TNRC6B|ENST00000301923.13|5,6,7,8 | circTNRC6B(5,6,7,8) | TNRC6B | LLQIMVLPLGVSQMKAVLGGARWMIQEHRPQAGGTRPPTLPMP | AVLGGARWMIQEHRPQAGGTRPPTLPMP | No | Alternative | Alternative | 28 | 1 | CTG | TGA | NA | No |
chr22|40246014|40270280|+|4|circRNA|TNRC6B|ENST00000301923.13|5,6,7,8 | circTNRC6B(5,6,7,8) | TNRC6B | LLQIMVLPLGVSQMKAVLGGARWMIQEHRPQAGGTRPPTLPMP | LLQIMVLPLGVSQMKAVLGGAR | No | Alternative | Alternative | 22 | 1 | CTG | TGA | NA | No |
Page 1 of 1
bottom of page