top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr22|37687909|37688992|+|3|circRNA|NOL12|ENST00000493862.5|2,3,4 | circNOL12(2,3,4) | NOL12 | LDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGVPDRLPQAEGRAKEGSH | GVPDRLPQAEGR | No | Alternative | Junction | 12 | 3 | CTG | TGA | TransCirc | No |
chr22|37815417|37816725|+|4|circRNA|GCAT|ENST00000323205.10|6,7,8,9 | circGCAT(6,7,8,9) | GCAT | LSSGSATPWSPRARPGSGYRSQQCIARKTLTAAWRPSWKWGDCTGHCPELWGHR | ARPGSGYRSQQCIAR | No | Alternative | Junction | 15 | 1 | TTG | TGA | TransCirc | No |
chr22|37870175|37878171|+|4|circRNA|EIF3L|ENST00000412331.6|8,9,10,11 | circEIF3L(8,9,10,11) | EIF3L | MSRCMRCWPLPSRCTPCVLMRAFTSSCGRNMGTRCCACRKVTHKSMKNFSVTPAPSSCRL | CMRCWPLPSR | No | Alternative | Alternative | 10 | 2 | ATG | TAG | TransCirc | No |
chr22|37870175|37878171|+|4|circRNA|EIF3L|ENST00000412331.6|8,9,10,11 | circEIF3L(8,9,10,11) | EIF3L | MSRCMRCWPLPSRCTPCVLMRAFTSSCGRNMGTRCCACRKVTHKSMKNFSVTPAPSSCRL | CTPCVLMR | No | Alternative | Alternative | 8 | 2 | ATG | TAG | TransCirc | No |
chr22|37870175|37878171|+|4|circRNA|EIF3L|ENST00000412331.6|8,9,10,11 | circEIF3L(8,9,10,11) | EIF3L | MSRCMRCWPLPSRCTPCVLMRAFTSSCGRNMGTRCCACRKVTHKSMKNFSVTPAPSSCRL | VTHKSMK | No | Alternative | Alternative | 7 | 2 | ATG | TAG | TransCirc | No |
Page 1 of 1
bottom of page