top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr22|29511105|29519120|-|5|circRNA|THOC5|ENST00000490103.5|19,18,17,16,15 | circTHOC5(19,18,17,16,15) | THOC5 | MFTWRPRAMTTVWRGPRNFPRRRCVCGSSANSDC | AMTTVWRGPR | No | Alternative | Junction | 10 | 2 | ATG | TGA | TransCirc | No |
chr22|29560852|29561170|-|1|ciRNA|NIPSNAP1|ENST00000216121.11|7 | ciNIPSNAP1(7) | NIPSNAP1 | LHQPWLLRKWQHQDWGWGRRTLLTCPTKAPGGPPFPGPYHRELFTFCPSWIWEKDPARR | WQHQDWGWGR | No | Alternative | Junction | 10 | 3 | CTG | TGA | NA | No |
chr22|29560852|29561170|-|1|ciRNA|NIPSNAP1|ENST00000216121.11|7 | ciNIPSNAP1(7) | NIPSNAP1 | LLTCPTKAPGGPPFPGPYHRELFTFCPSWIWEKDPARR | APGGPPFPGPYHR | No | Alternative | Alternative | 13 | 3 | CTG | TGA | NA | No |
chr22|29978441|30009129|+|9|circRNA|MTMR3|ENST00000401950.6|4,5,6,7,8,9,10,11,12 | circMTMR3(4,5,6,7,8,9,10,11,12) | MTMR3 | MGMANIHSIRRSFQSLRLLCTQMPDPGKMKRLGTALSASRPIRSFPGSS | LLCTQMPDPGK | No | Alternative | Junction | 11 | 3 | ATG | TGA | TransCirc | No |
chr22|30694207|30741369|+|2|circRNA|OSBP2|ENST00000438716.3|2,3 | circOSBP2(2,3) | OSBP2 | LWYLADQWGQELPPQGQLRGGPAAVDHRPGAGQGQGCPRDEHSFREPERCRHWQRSALA | LWYLADQWGQELPPQGQLR | No | Alternative | Junction | 19 | 1 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page