top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr21|46436978|46442573|+|5|circRNA|PCNT|ENST00000359568.9|40,41,42,43,44 | circPCNT(40,41,42,43,44) | PCNT | LVKKWQEVDRKGALAQGKAPRPGQLMIGRHPMRKQ | GALAQGKAPRPGQLMIGR | No | Junction | Junction | 18 | 2 | TTG | TGA | TransCirc | No |
chr21|46509256|46511614|+|2|circRNA|DIP2A|ENST00000400274.5|7,8 | circDIP2A(7,8) | DIP2A | LGHNTAQIPLSDCLGYNWESRLHSHLWCPCEQQSVLQNPAASEHPEEAKAPSTEGVLCG | APSTEGVLCG | No | Alternative | Junction | 10 | 2 | CTG | TGA | TransCirc | No |
chr21|46509256|46511614|+|2|circRNA|DIP2A|ENST00000400274.5|7,8 | circDIP2A(7,8) | DIP2A | LGHNTAQIPLSDCLGYNWESRLHSHLWCPCEQQSVLQNPAASEHPEEAKAPSTEGVLCG | LGHNTAQIPLSDCLGYNWESR | No | Alternative | Junction | 21 | 2 | CTG | TGA | TransCirc | No |
chr22|17477587|17505016|+|6|circRNA|CECR2|ENST00000400585.6|2,3,4,5,6,7 | circCECR2(2,3,4,5,6,7) | CECR2 | LVAPVPDRRGMETGHREFSREDLPSRTAALQAPQ | LVAPVPDRR | No | Alternative | Alternative | 9 | 2 | TTG | TGA | TransCirc | No |
chr22|17655661|17696210|+|4|circRNA|BCL2L13|ENST00000399782.5|3,4,5,6 | circBCL2L13(3,4,5,6) | BCL2L13 | MPAAGIRFYTSISRPFWSLTSQFNGVLFYCASGISL | MPAAGIR | No | Alternative | Junction | 7 | 3 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page