top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr21|42518276|42525857|+|2|circRNA|SLC37A1|ENST00000398341.7|3,4 | circSLC37A1(3,4) | SLC37A1 | LTFLLYASFHLSRKPISIVKRAEPLPEGRGQDPAGHLLSTLSSLWERQGQQREDLEPGLMTHL | GQDPAGHLLSTLSSLWER | No | Alternative | Junction | 18 | 2 | TTG | TGA | TransCirc | No |
chr21|42862281|42863596|-|2|circRNA|WDR4|NM_033661|5,4 | circWDR4(5,4) | WDR4 | LMTASSSLPTGTRRSESAGPRRPIASSPSAWGTQRPWQGGVQP | SESAGPR | No | Alternative | Junction | 7 | 2 | CTG | TGA | TransCirc | No |
chr21|43967945|43978121|+|5|circRNA|AGPAT3|ENST00000291572.12|4,5,6,7,8 | circAGPAT3(4,5,6,7,8) | AGPAT3 | MKRKQLSGFINCTRRRTGHAAGVVVLHGVYTVHGPGHGRALWEGARSHHPQPQLRDRLPLWVDHV | ALWEGAR | No | Alternative | Junction | 7 | 3 | ATG | TGA | TransCirc | No |
chr21|43969117|43971490|+|3|circRNA|AGPAT3|ENST00000291572.12|5,6,7 | circAGPAT3(5,6,7) | AGPAT3 | LNFRGNKNPSLLGILYGKKYEADMCVRAPRSSLRRSCSTCPSSAGRGTFWRLCSASGSGRRTGTPWSKG | APRSSLR | No | Alternative | Junction | 7 | 3 | CTG | TGA | TransCirc | No |
chr21|43969117|43971490|+|3|circRNA|AGPAT3|ENST00000291572.12|5,6,7 | circAGPAT3(5,6,7) | AGPAT3 | LNFRGNKNPSLLGILYGKKYEADMCVRAPRSSLRRSCSTCPSSAGRGTFWRLCSASGSGRRTGTPWSKG | GTFWRLCSASGSGR | No | Alternative | Junction | 14 | 3 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page