top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr20|62256056|62272259|+|4|circRNA|OSBPL2|ENST00000622332.4|2,3,4,5 | circOSBPL2(2,3,4,5) | OSBPL2 | LSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQIFSVYWIFPRESL | ASCQPQPLERMQIFSVYWIFPR | No | Junction | Junction | 22 | 1 | CTG | TAA | TransCirc | No |
chr20|62333900|62334621|-|3|circRNA|LAMA5|NM_005560|23,22,21 | circLAMA5(23,22,21) | LAMA5 | LARLPIRQPGGHECERAGLCARGGQVGHLRQLLPV | GGQVGHLRQLLPV | No | Junction | Junction | 13 | 3 | CTG | TGA | TransCirc | No |
chr20|62352241|62362552|-|3|circRNA|LAMA5|NM_005560|4,3,2 | circLAMA5(4,3,2) | LAMA5 | LSGAVRATDAGAHHTGRRGHLHHRVLTHRAPGERRGPVL | ATDAGAHHTGRR | No | Alternative | Junction | 12 | 2 | CTG | TGA | TransCirc | No |
chr20|62661175|62664896|+|1|ciRNA|SLCO4A1|ENST00000217159.5|5 | ciSLCO4A1(5) | SLCO4A1 | LAIVGGGCGQWVSPCCLPSTRIGGKASGPKVAPQKAPSCPRQRGAGLDEDGKERPH | ASGPKVAPQK | No | Alternative | Alternative | 10 | 2 | CTG | TAG | NA | No |
chr20|62661175|62664896|+|1|ciRNA|SLCO4A1|ENST00000217159.5|5 | ciSLCO4A1(5) | SLCO4A1 | LAIVGGGCGQWVSPCCLPSTRIGGKASGPKVAPQKAPSCPRQRGAGLDEDGKERPH | GAGLDEDGK | No | Alternative | Alternative | 9 | 2 | CTG | TAG | NA | No |
Page 1 of 1
bottom of page