top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr20|34732558|34743341|-|3|circRNA|NCOA6|ENST00000374796.6|14,13,12 | circNCOA6(14,13,12) | NCOA6 | MWLRQPRHLGPKHQTEPAPDPIILRHPTTALPAQNLQKSVCHQKDSMPP | HPTTALPAQNLQKSVCHQK | No | Alternative | Alternative | 19 | 2 | ATG | TAG | TransCirc | No |
chr20|34854530|34856893|-|3|circRNA|GGT7|NM_178026|10,9,8 | circGGT7(10,9,8) | GGT7 | LKIALALASRLGDPVYDSTITESMDDMLRLSTQGVS | LGDPVYDSTITESMDDMLR | No | Alternative | Junction | 19 | 1 | CTG | TAA | TransCirc | No |
chr20|34941712|34943006|-|3|circRNA|GSS|ENST00000216951.6|6,5,4 | circGSS(6,5,4) | GSS | LARSSLIIPARDWPWELPKPGSSTAHPTPSNRMTLPLVSLTSTSKS | SSLIIPAR | No | Alternative | Junction | 8 | 3 | CTG | TAA | TransCirc | No |
chr20|35123889|35131783|-|3|circRNA|EDEM2|NM_001145025|8,7,6 | circEDEM2(8,7,6) | EDEM2 | MEAVWGAPGILQHSSGIHSGEARGLPTSARSATTLMCSLASGWPRTQASGLAWTPTLSTW | TQASGLAWTPTLSTW | No | Alternative | Junction | 15 | 3 | ATG | TGA | TransCirc | No |
chr20|35123889|35138005|-|5|circRNA|EDEM2|NM_001145025|8,7,6,5,4 | circEDEM2(8,7,6,5,4) | EDEM2 | MEAVWGAPGILQHSSGIHSGEARGLPTSASGRRTPVCSSALQEGWGGSRGWMALFRASPENG | GLPTSASGR | No | Junction | Junction | 9 | 3 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page