top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr20|17629984|17633459|-|1|ciRNA|RRBP1|ENST00000610403.4|7 | ciRRBP1(7) | RRBP1 | LPSPEAPSLPASSAGMRAGVACADLRSWSTGIREVPCPSLPVSPRTASWGLLGRKYPLKVLMTSF | TASWGLLGR | No | Alternative | Alternative | 9 | 1 | CTG | TAG | NA | No |
chr20|17629984|17633459|-|1|ciRNA|RRBP1|ENST00000610403.4|7 | ciRRBP1(7) | RRBP1 | LVLPRLHCVSRGSGRLSALFTAQQACLHSGDGPRLAVPHWAPVSSLDWDR | LAVPHWAPVSSLDWDR | No | Alternative | Junction | 16 | 2 | CTG | TGA | NA | No |
chr20|18628126|18744271|+|2|circRNA|DTD1|ENST00000377452.3|4,5 | circDTD1(4,5) | DTD1 | LNQARKETLPEKKTAVPAAGLRATCPLNGSRSSGGRIQMASLGPTCRCTFRMMGL | TAVPAAGLR | No | Alternative | Junction | 9 | 2 | CTG | TGA | NA | No |
chr20|20524405|20535803|-|5|circRNA|RALGAPA2|ENST00000430436.5|24,23,22,21,20 | circRALGAPA2(24,23,22,21,20) | RALGAPA2 | LPLGLVHGIARECPSPPRVHSSPRGAAFGQSPLAGLYLQALPHKYFTEECHRRTK | GAAFGQSPLAGLYLQALPHK | No | Junction | Junction | 20 | 3 | CTG | TGA | NA | No |
chr20|20524405|20535803|-|5|circRNA|RALGAPA2|ENST00000430436.5|24,23,22,21,20 | circRALGAPA2(24,23,22,21,20) | RALGAPA2 | LPLGLVHGIARECPSPPRVHSSPRGAAFGQSPLAGLYLQALPHKYFTEECHRRTK | GAAFGQSPLAGLYLQALPHKYFTEECHR | No | Junction | Junction | 28 | 3 | CTG | TGA | NA | No |
Page 1 of 1
bottom of page