top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr2|9591516|9630158|-|1|ciRNA|YWHAQ|NM_006826|2 | ciYWHAQ(2) | YWHAQ | LYLCYRLYLEKWKNNGASGETMMIRTYINLNAFLKDGHRL | NNGASGETMMIR | No | Alternative | Alternative | 12 | 1 | CTG | TGA | NA | No |
chr2|96237904|96240688|+|2|circRNA|STARD7-AS1|NR_046322|2,3 | circSTARD7-AS1(2,3) | STARD7-AS1 | LCVLPHGLQVSDPKLQIMSSSLGSGREFGSTLIILAAACVEIISHYSGGQALCRGLSGPA | LQIMSSSLGSGR | No | Alternative | Alternative | 12 | 2 | CTG | TGA | NA | No |
chr2|9630158|9630534|-|1|circRNA|YWHAQ|NM_006826|2 | circYWHAQ(2) | YWHAQ | LHEGSDRAGRRAVQRGAQPALRGLQERGRGPQVRLEGHL | GRGPQVR | No | Alternative | Alternative | 7 | 1 | CTG | TAG | TransCirc | No |
chr2|97217372|97219048|+|1|ciRNA|ANKRD36|ENST00000461153.6|64 | ciANKRD36(64) | ANKRD36 | LCTFSVIRQAIEHDECLCYTGIKPSDVLYESHAVAVSTSFYTYF | QAIEHDECLCYTGIKPSDVLYESHAVAVSTSFYTYF | No | Alternative | Alternative | 36 | 1 | TTG | TAG | NA | No |
chr2|97241265|97246071|+|3|circRNA|ANKRD36|ENST00000461153.6|69,70,71 | circANKRD36(69,70,71) | ANKRD36 | MMLATKLTIKKKQYLIFKPDVMLEYKTFKLSAESTVFY | QYLIFKPDVMLEYK | No | Alternative | Alternative | 14 | 2 | ATG | TAG | TransCirc | No |
Page 1 of 1
bottom of page