top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|5387671|5394595|-|3|circRNA|TNRC18|ENST00000399537.8|5,4,3 | circTNRC18(5,4,3) | TNRC18 | LAAATPRAPRPKARRRGTVQPRSGRAAAGSRLRFSARRTRAPGARRPRGHGAWWT | AAAGSRLR | No | Alternative | Alternative | 8 | 1 | CTG | TGA | TransCirc | No |
chr7|5387671|5394595|-|3|circRNA|TNRC18|ENST00000399537.8|5,4,3 | circTNRC18(5,4,3) | TNRC18 | LAAATPRAPRPKARRRGTVQPRSGRAAAGSRLRFSARRTRAPGARRPRGHGAWWT | LAAATPR | No | Alternative | Alternative | 7 | 1 | CTG | TGA | TransCirc | No |
chr7|5387671|5394595|-|3|circRNA|TNRC18|ENST00000399537.8|5,4,3 | circTNRC18(5,4,3) | TNRC18 | METLRAGQLRRHADGRAGRAAPPQPRRRGGRRGRCLLLQEGLPGPWGCAAPLGGHLRPAGR | HADGRAGR | No | Alternative | Alternative | 8 | 2 | ATG | TGA | TransCirc | No |
chr7|55142285|55143488|+|2|circRNA|EGFR|ENST00000455089.5|2,3 | circEGFR(2,3) | EGFR | LKIIFSASRGCSITVRWSLGIWKLPMCRGIMIFPS | IIFSASR | No | Alternative | Alternative | 7 | 2 | TTG | TAA | TransCirc | No |
chr7|55163732|55165437|+|2|circRNA|EGFR|ENST00000455089.5|13,14 | circEGFR(13,14) | EGFR | LTAPTASRPARQESWEKTTPWSGSTQTPAMCATCAIQTAPTVSQGSLWRTLSAYSATQSACLRP | LTAPTASRPAR | No | Alternative | Junction | 11 | 2 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page