top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr2|26279993|26285571|+|6|circRNA|HADHB|ENST00000537713.5|9,10,11,12,13,14 | circHADHB(9,10,11,12,13,14) | HADHB | LPPLEKFNNWGGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQEKIQLPKIMASVLPHWSRWPN | KEGGQYGLVAACAAGGQEK | No | Junction | Junction | 19 | 1 | TTG | TAA | TransCirc | No |
chr2|27206534|27206876|-|1|ciRNA|SLC5A6|ENST00000310574.7|4 | ciSLC5A6(4) | SLC5A6 | LAGLKFLLEVSICEDPRGILLPMPSNSSTDTVVAASQNLRGEGRGK | GILLPMPSNSSTDTVVAASQNLRGEGR | No | Alternative | Alternative | 27 | 2 | TTG | TGA | NA | No |
chr2|27366758|27367201|-|2|circRNA|EIF2B4|NM_172195|10,9 | circEIF2B4(10,9) | EIF2B4 | LDRGPAVSGGSGGQPAMAGRKAHTTFSSPCWCPSLLPADSCSLLCAPRGQVRTSSSH | GPAVSGGSGGQPAMAGR | No | Alternative | Junction | 17 | 1 | TTG | TGA | TransCirc | No |
chr2|27366758|27367201|-|2|circRNA|EIF2B4|NM_172195|10,9 | circEIF2B4(10,9) | EIF2B4 | LDRGPAVSGGSGGQPAMAGRKAHTTFSSPCWCPSLLPADSCSLLCAPRGQVRTSSSH | GPAVSGGSGGQPAMAGRK | No | Alternative | Junction | 18 | 1 | TTG | TGA | TransCirc | No |
chr2|27453383|27454660|-|5|circRNA|IFT172|ENST00000260570.7|35,34,33,32,31 | circIFT172(35,34,33,32,31) | IFT172 | LWNKLDTGSRLESTAVPWTATSKCETLETAAWRRSAG | CETLETAAWR | No | Alternative | Alternative | 10 | 3 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page