top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr2|208271510|208285933|+|5|circRNA|PIKFYVE|NM_001178000|2,3,4,5,6 | circPIKFYVE(2,3,4,5,6) | PIKFYVE | LNALSDSACSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQRLMKWPQMIRRPQHWTLLMICLDLLLVLLISHTLNL | LMKWPQMIR | No | Alternative | Junction | 9 | 3 | TTG | TGA | TransCirc | No |
chr2|208335305|208348023|+|11|circRNA|PIKFYVE|ENST00000264380.8|25,26,27,28,29,30,31,32,33,34,35 | circPIKFYVE(25,26,27,28,29,30,31,32,33,34,35) | PIKFYVE | LECCPSSEGQQGKAPISLPRRERPYVEQIVLTTRLGRRARRGPRIKALSLKLFSHSAS | APISLPR | No | Alternative | Junction | 7 | 1 | CTG | TGA | TransCirc | No |
chr2|210031466|210032924|+|2|circRNA|AC007038.7|NR_110291|2,3 | circAC007038.7(2,3) | AC007038.7 | LSITASMMSIENSKNLNTNTIKKEVQTTSGRTISRNNEAFMEYRLATL | LSITASMMSIENSK | No | Alternative | Alternative | 14 | 2 | CTG | TAA | NA | No |
chr2|215326821|215338907|+|6|circRNA|ATIC|ENST00000236959.13|7,8,9,10,11,12 | circATIC(7,8,9,10,11,12) | ATIC | MVSSTSHYLAMLLPKIKMHSLIRHNMMKQFQIISGNSTAKAYLRCP | HNMMKQFQIISGNSTAK | No | Alternative | Junction | 17 | 2 | ATG | TGA | TransCirc | No |
chr2|215326821|215338907|+|6|circRNA|ATIC|ENST00000236959.13|7,8,9,10,11,12 | circATIC(7,8,9,10,11,12) | ATIC | MVSSTSHYLAMLLPKIKMHSLIRHNMMKQFQIISGNSTAKAYLRCP | IKMHSLIR | No | Alternative | Junction | 8 | 2 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page