top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr2|200920221|200937966|-|8|circRNA|ORC2|ENST00000234296.6|15,14,13,12,11,10,9,8 | circORC2(15,14,13,12,11,10,9,8) | ORC2 | LVKQSGSLPLSSLTHVLRSLTPNARTMTKVNFCQQHLVV | TMTKVNFCQQHLVV | No | Alternative | Junction | 14 | 3 | CTG | TAA | TransCirc | No |
chr2|201205881|201209562|+|3|circRNA|CASP10|ENST00000286186.10|7,8,9 | circCASP10(7,8,9) | CASP10 | MGDLELSTLRMRPSFPFGRSCLTSQPCSALDWLKNLNSFSSRPAKVKRYSLPYPSKQML | NLNSFSSRPAK | No | Alternative | Alternative | 11 | 1 | ATG | TGA | TransCirc | No |
chr2|201728511|201754671|-|10|circRNA|ALS2|NM_020919|15,14,13,12,11,10,9,8,7,6 | circALS2(15,14,13,12,11,10,9,8,7,6) | ALS2 | MMPWSMPSFPQALKKGCTGENEDSGSDPHIQWRSRCAPAFSENRSVDLGEREGRAAGARRCSA | EGRAAGAR | No | Alternative | Junction | 8 | 2 | ATG | TAG | TransCirc | No |
chr2|202464808|202467689|+|2|circRNA|BMPR2|NM_001204|2,3 | circBMPR2(2,3) | BMPR2 | MEHTVSAVVAQIYVMSTLLRIFHLLTQHHSLRRIKNGYVRLKIRISKTLG | IFHLLTQHHSLR | No | Junction | Junction | 12 | 1 | ATG | TAG | riboCIRC,TransCirc | No |
chr2|202464808|202530954|+|7|circRNA|BMPR2|NM_001204|2,3,4,5,6,7,8 | circBMPR2(2,3,4,5,6,7,8) | BMPR2 | LSMRLTGNRLVRPGEEDNAAISELRRIKNGYVRLKIRISKTLG | LVRPGEEDNAAISELR | No | Junction | Junction | 16 | 3 | CTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page