top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr2|191414047|191416242|+|3|circRNA|MYO1B|ENST00000339514.8|26,27,28 | circMYO1B(26,27,28) | MYO1B | LKWPPSSIAQLSAKPNRSSILRFPMMLGNHSKGLTWKSTRTPSIRNSKMPLKKRSSLLKS | GLTWKSTR | No | Alternative | Junction | 8 | 2 | TTG | TGA | TransCirc | No |
chr2|196719496|196732152|+|9|circRNA|CCDC150|ENST00000431807.6|14,15,16,17,18,19,20,21,22 | circCCDC150(14,15,16,17,18,19,20,21,22) | CCDC150 | LGKTGGRKRWETFSDNWQKLKKTTAKSQSCWRMCWLLTVRCKVLWRKYK | LGKTGGR | No | Alternative | Junction | 7 | 2 | CTG | TAG | TransCirc | No |
chr2|196995378|197005910|-|6|circRNA|ANKRD44|ENST00000424317.5|20,19,18,17,16,15 | circANKRD44(20,19,18,17,16,15) | ANKRD44 | LTRYKTRALLMKKIMHCRHYDRTRGMCANAAGTRSVNSL | GMCANAAGTR | No | Alternative | Junction | 10 | 2 | TTG | TAA | NA | No |
chr2|197408368|197418588|-|4|circRNA|SF3B1|ENST00000335508.10|8,7,6,5 | circSF3B1(8,7,6,5) | SF3B1 | LGMEVDGLRLLEQIEVEILLVKHRLLEPVKENHGGMKHQLVRWVEALQF | LGMEVDGLR | No | Alternative | Alternative | 9 | 1 | CTG | TGA | NA | No |
chr2|199308759|199349173|-|4|circRNA|SATB2|ENST00000417098.5|10,9,8,7 | circSATB2(10,9,8,7) | SATB2 | MRGMSSMRRSQGITTANACNTWSSFPLSRCSGKSGTRKPFRLLCSGPASNAFTKYEPAGIPGENQRTVSSQPNSPQYSNPKPSARITAHHEPWSSFSPA | ITAHHEPWSSFSPA | No | Alternative | Junction | 14 | 2 | ATG | TAG | TransCirc | No |
Page 1 of 1
bottom of page