top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr2|171448680|171458477|+|5|circRNA|DCAF17|ENST00000539783.5|4,5,6,7,8 | circDCAF17(4,5,6,7,8) | DCAF17 | MQQKLDLGCACRWGGTTGTVGEAPFGIPCNIKITGRYTSQFIRL | WGGTTGTVGEAPFGIPCNIKITGR | No | Junction | Junction | 24 | 1 | ATG | TAA | TransCirc | No |
chr2|172465538|172480051|+|10|circRNA|ITGA6|NM_001316306|2,3,4,5,6,7,8,9,10,11 | circITGA6(2,3,4,5,6,7,8,9,10,11) | ITGA6 | LNILLTPLVIILQYVARGGPAGRSASTAESQQNGRAVQLRHHRPGAMHADRV | GGPAGRSASTAESQQNGR | No | Alternative | Junction | 18 | 3 | TTG | TGA | TransCirc | No |
chr2|172484781|172485264|+|2|circRNA|ITGA6|NM_001316306|12,13 | circITGA6(12,13) | ITGA6 | LRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDQLWAHLKLKKKEENLGYPQEFSFETKVLSPNILKN | KEENLGYPQEFSFETK | No | Alternative | Junction | 16 | 1 | CTG | TAA | TransCirc | No |
chr2|172795024|172814425|+|3|circRNA|RAPGEF4|ENST00000484331.5|2,3,4 | circRAPGEF4(2,3,4) | RAPGEF4 | LGIGTAFGESILDNTPRHATIVTRESSELLRIEQKDFKALWETTGAIQRRCGYNLHSTERS | ALWETTGAIQR | No | Junction | Junction | 11 | 1 | CTG | TAA | TransCirc | No |
chr2|172960759|172967444|+|4|circRNA|RAPGEF4|NM_007023|7,8,9,10 | circRAPGEF4(7,8,9,10) | RAPGEF4 | MMSTRMPLCLLRRRRRSVMRSSRTPCCCCHRWAPTPT | SVMRSSR | No | Alternative | Alternative | 7 | 1 | ATG | TGA | NA | No |
Page 1 of 1
bottom of page