top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr2|159967538|159987358|-|9|circRNA|PLA2R1|ENST00000283243.11|20,19,18,17,16,15,14,13,12 | circPLA2R1(20,19,18,17,16,15,14,13,12) | PLA2R1 | MERVPKDGYILTIRLQWWLCCHARKASTWSLGSEALSAL | DGYILTIR | No | Alternative | Junction | 8 | 1 | ATG | TAA | TransCirc | No |
chr2|159967538|159987358|-|9|circRNA|PLA2R1|ENST00000283243.11|20,19,18,17,16,15,14,13,12 | circPLA2R1(20,19,18,17,16,15,14,13,12) | PLA2R1 | MERVPKDGYILTIRLQWWLCCHARKASTWSLGSEALSAL | DGYILTIRLQWWLCCHAR | No | Junction | Junction | 18 | 1 | ATG | TAA | TransCirc | No |
chr2|159967538|159987358|-|9|circRNA|PLA2R1|ENST00000283243.11|20,19,18,17,16,15,14,13,12 | circPLA2R1(20,19,18,17,16,15,14,13,12) | PLA2R1 | MERVPKDGYILTIRLQWWLCCHARKASTWSLGSEALSAL | KASTWSLGSEALSAL | No | Alternative | Junction | 15 | 1 | ATG | TAA | TransCirc | No |
chr2|159967538|159987358|-|9|circRNA|PLA2R1|ENST00000283243.11|20,19,18,17,16,15,14,13,12 | circPLA2R1(20,19,18,17,16,15,14,13,12) | PLA2R1 | MERVPKDGYILTIRLQWWLCCHARKASTWSLGSEALSAL | LQWWLCCHAR | No | Alternative | Junction | 10 | 1 | ATG | TAA | TransCirc | No |
chr2|160300650|160303487|-|2|circRNA|RBMS1|ENST00000474820.5|7,6 | circRBMS1(7,6) | RBMS1 | MESTEKCEAVIGHFNGKFIKTPPGVSATGTRSYQPLHF | TPPGVSATGTR | No | Junction | Junction | 11 | 2 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page