top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr2|135680172|135710231|+|3|circRNA|R3HDM1|NM_001282799|17,18,19 | circR3HDM1(17,18,19) | R3HDM1 | LSRFHCLKVLKEFPIRLINSLLCSLISLIKDLCPQQECLFTIVSFHLVNKTI | LINSLLCSLISLIK | No | Alternative | Junction | 14 | 1 | TTG | TAA | TransCirc | No |
chr2|135803929|135812956|-|5|circRNA|LCT|ENST00000264162.6|11,10,9,8,7 | circLCT(11,10,9,8,7) | LCT | LLIFWVCRITPPASSATPHKTPASLAMIPLEASPNT | LLIFWVCR | No | Alternative | Alternative | 8 | 3 | CTG | TGA | TransCirc | No |
chr2|144141881|144235737|-|5|circRNA|GTDC1|ENST00000409214.5|6,5,4,3,2 | circGTDC1(6,5,4,3,2) | GTDC1 | LVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRYLCISQIGHM | FPDVSRYLCISQIGHM | No | Junction | Junction | 16 | 2 | CTG | TAA | TransCirc | No |
chr2|144141881|144235737|-|5|circRNA|GTDC1|ENST00000409214.5|6,5,4,3,2 | circGTDC1(6,5,4,3,2) | GTDC1 | LVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRYLCISQIGHM | YLCISQIGHM | No | Alternative | Junction | 10 | 2 | CTG | TAA | TransCirc | No |
chr2|147896300|147899567|+|2|circRNA|ACVR2A|ENST00000241416.11|2,3 | circACVR2A(2,3) | ACVR2A | LKYIFVAVRAICVMKSFLIFRRWKSHSVLYLVDQKLRSVFSLMLIGKKTEPIKLVLNRVMVTKINGGIVLLPGRIFLVPLK | INGGIVLLPGR | No | Alternative | Junction | 11 | 3 | CTG | TAG | riboCIRC | No |
Page 1 of 1
bottom of page