top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr6|89738325|89743714|-|4|circRNA|MDN1|ENST00000369393.7|33,32,31,30 | circMDN1(33,32,31,30) | MDN1 | LSPALRNRFTEIWCPQSTSREDLIQIISHNLRPGLCLGRIDPKGVGKLLSVRYLQPWQIRNYTLSAATYTWRHQTSWVACGQ | IDPKGVGK | No | Junction | Junction | 8 | 1 | CTG | TGA | TransCirc | No |
chr6|89749222|89751582|-|4|circRNA|MDN1|ENST00000369393.7|26,25,24,23 | circMDN1(26,25,24,23) | MDN1 | LWNCTLMSYLAPSWKQSCTSGVVCHPPIAASWLKSCWIFSLFQSQKEVGLSRLKATGLRWETRSLQ | ATGLRWETR | No | Alternative | Junction | 9 | 2 | TTG | TAG | TransCirc | No |
chr6|89749222|89751582|-|4|circRNA|MDN1|ENST00000369393.7|26,25,24,23 | circMDN1(26,25,24,23) | MDN1 | LWNCTLMSYLAPSWKQSCTSGVVCHPPIAASWLKSCWIFSLFQSQKEVGLSRLKATGLRWETRSLQ | LKATGLR | No | Alternative | Junction | 7 | 2 | TTG | TAG | TransCirc | No |
chr6|89857083|89864371|+|2|circRNA|CASP8AP2|ENST00000551025.3|6,7 | circCASP8AP2(6,7) | CASP8AP2 | LAVVMVNQGYWRLVKGYKDILRNMVKVNQRLKAKVRSLKVTQILTIKVNALTLLGRKRPLEKGHTVE | GYKDILR | No | Alternative | Alternative | 7 | 3 | CTG | TAG | TransCirc | No |
chr6|90088960|90206681|-|2|circRNA|BACH2|NM_001170794|3,2 | circBACH2(3,2) | BACH2 | LPHKTLGSMSEWIARAFSSLPSPSSLHPKTRRQHRTWKNYIAAVCFRK | AFSSLPSPSSLHPK | No | Alternative | Junction | 14 | 1 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page