top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr6|75647730|75695923|+|11|circRNA|SENP6|ENST00000370010.6|6,7,8,9,10,11,12,13,14,15,16 | circSENP6(6,7,8,9,10,11,12,13,14,15,16) | SENP6 | LTEFIYSVLFSINALIRERGEIMKQLICRKNTHLMSKKLKLIL | LTEFIYSVLFSINALIR | No | Alternative | Junction | 17 | 3 | CTG | TAA | TransCirc | No |
chr6|75817500|75830545|+|4|circRNA|MYO6|NM_001300899|2,3,4,5 | circMYO6(2,3,4,5) | MYO6 | LGQDHLMSLQLVTVDSGNRRSWILLQKWRMESPFGRHTLQMDFRWAILWILAPTA | LGQDHLMSLQLVTVDSGNR | No | Junction | Junction | 19 | 2 | TTG | TAA | TransCirc | No |
chr6|82957311|83044659|-|6|circRNA|UBE3D|ENST00000237186.10|9,8,7,6,5,4 | circUBE3D(9,8,7,6,5,4) | UBE3D | LWESDISVHPLTLPSATCLELLLILSKSNANLPSSLRRVNSFQEAPQGAPTAE | RVNSFQEAPQGAPTAE | No | Junction | Junction | 16 | 2 | TTG | TGA | TransCirc | No |
chr6|83137172|83145658|+|5|circRNA|DOPEY1|ENST00000237163.9|21,22,23,24,25 | circDOPEY1(21,22,23,24,25) | DOPEY1 | LLWKKVSQRTALLISQRMNLTMAARCSHNFLRCFRG | CSHNFLRCFR | No | Alternative | Alternative | 10 | 1 | TTG | TGA | NA | No |
chr6|83137172|83145658|+|5|circRNA|DOPEY1|ENST00000237163.9|21,22,23,24,25 | circDOPEY1(21,22,23,24,25) | DOPEY1 | LLWKKVSQRTALLISQRMNLTMAARCSHNFLRCFRG | TALLISQRMNLTMAAR | No | Alternative | Alternative | 16 | 1 | TTG | TGA | NA | No |
Page 1 of 1
bottom of page