top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr6|54870186|54870690|+|1|circRNA|FAM83B|ENST00000306858.7|2 | circFAM83B(2) | FAM83B | LAICDARTLRGHPYRSPFSSTKSTSTYDKRNYSEDDKRSKKDTSHHCMNGHLKVP | DTSHHCMNGHLKVP | No | Alternative | Junction | 14 | 3 | CTG | TAG | NA | No |
chr6|54870186|54870690|+|1|circRNA|FAM83B|ENST00000306858.7|2 | circFAM83B(2) | FAM83B | LAICDARTLRGHPYRSPFSSTKSTSTYDKRNYSEDDKRSKKDTSHHCMNGHLKVP | LAICDARTLR | No | Alternative | Junction | 10 | 3 | CTG | TAG | NA | No |
chr6|56508528|56573887|-|25|circRNA|DST|NM_015548|56,55,54,53,52,51,50,49,48,47,46,45,44,43,42,41,40,39,38,37,36,35,34,33,32 | circDST(56,55,54,53,52,51,50,49,48,47,46,45,44,43,42,41,40,39,38,37,36,35,34,33,32) | DST | MVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAEMTLLGDMRICPSLLMNEMKNSR | QQQEAAEMTLLGDMRICPSLLMNEMK | No | Junction | Junction | 26 | 3 | ATG | TAA | NA | No |
chr6|56851396|56900621|-|2|circRNA|DST|NM_001144769|4,3 | circDST(4,3) | DST | LRIFPMRMISARNLAPHPQLRETPYPGICLNMRDRKERFKGAQCWTLPRGQCFG | FKGAQCWTLPR | No | Alternative | Alternative | 11 | 2 | CTG | TAG | riboCIRC,TransCirc | No |
chr6|57128728|57148693|+|6|circRNA|ZNF451|ENST00000370706.8|5,6,7,8,9,10 | circZNF451(5,6,7,8,9,10) | ZNF451 | LWMKPAPKIISRIQDTKSESLTQWKNQSYSIATAAKGTRILLLTCIYCWINQNFHHLKEPCLLKNLAHWSALPFQKRR | LWMKPAPK | No | Alternative | Alternative | 8 | 3 | TTG | TGA | NA | No |
Page 1 of 1
bottom of page