top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr6|24563358|24572698|-|6|circRNA|KIAA0319|ENST00000430948.6|15,14,13,12,11,10 | circKIAA0319(15,14,13,12,11,10) | KIAA0319 | LVELTLQVGVGQLTEQRKDTLVRQLAVLLNVLDSDIKVQKIRAHSDLREYRRHTFIYLQCRKEIIHFS | HTFIYLQCR | No | Alternative | Junction | 9 | 3 | CTG | TGA | TransCirc | No |
chr6|25449897|25606273|+|30|circRNA|LRRC16A|ENST00000329474.6|6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35 | circLRRC16A(6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35) | LRRC16A | LVWEHQKRIPKQNPKRKQAPGLGAHPAHLRARSPSCSPPNPVWQHGPSSRRNQEPPHGLENHEKSLHGAI | KQAPGLGAHPAHLR | Yes | Alternative | Junction | 14 | 1 | TTG | TGA | TransCirc | No |
chr6|25472426|25540078|+|16|circRNA|LRRC16A|ENST00000329474.6|11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26 | circLRRC16A(11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26) | LRRC16A | LLPNLYHVGGASWAGASGLLSSPIQETLESMAGEVTRVVDEQLKRFCTKTGQCSST | TGQCSST | No | Alternative | Junction | 7 | 1 | TTG | TAA | TransCirc | No |
chr6|25963048|25969420|+|3|circRNA|TRIM38|NM_006355|2,3,4 | circTRIM38(2,3,4) | TRIM38 | MSGAQDRNPGALEGGEPHLPRRAVTPAERGLVYHWRK | AVTPAERGLVYHWR | No | Alternative | Alternative | 14 | 3 | ATG | TAG | TransCirc | No |
chr6|25963048|25969420|+|3|circRNA|TRIM38|NM_006355|2,3,4 | circTRIM38(2,3,4) | TRIM38 | MSGAQDRNPGALEGGEPHLPRRAVTPAERGLVYHWRK | MSGAQDRNPGALEGGEPHLPR | No | Alternative | Alternative | 21 | 3 | ATG | TAG | TransCirc | No |
Page 1 of 1
bottom of page