top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr6|169769539|169779295|+|6|circRNA|ERMARD|ENST00000366772.6|12,13,14,15,16,17 | circERMARD(12,13,14,15,16,17) | ERMARD | LSPVLSLILLLIALELVNIHAVCGKNAHEYQQYLKNFSGIS | NAHEYQQYLKNFSGIS | No | Junction | Junction | 16 | 2 | CTG | TGA | TransCirc | No |
chr6|170317369|170330550|+|3|circRNA|FAM120B|ENST00000630384.2|2,3,4 | circFAM120B(2,3,4) | FAM120B | LPSCQGVVCVSWEPTEAPGPRQAAADDHSRSFPGVQLWV | QAAADDHSRSFPGVQLWV | No | Junction | Junction | 18 | 2 | CTG | TGA | TransCirc | No |
chr6|17462995|17507726|+|3|circRNA|CAP2|ENST00000229922.6|4,5,6 | circCAP2(4,5,6) | CAP2 | MNDAATFYTNRVLKDYKHRQKWCTVLSRPSGLSF | QKWCTVLSRPSGLSF | No | Alternative | Junction | 15 | 1 | ATG | TGA | TransCirc | No |
chr6|17794248|17800113|-|5|circRNA|KIF13A|ENST00000378814.9|25,24,23,22,21 | circKIF13A(25,24,23,22,21) | KIF13A | LCNCQVHQTPKRAGQLPGCRASPRGSDACYRSCSRACGGG | ASPRGSDACYR | No | Alternative | Junction | 11 | 3 | CTG | TGA | TransCirc | No |
chr6|17833960|17855617|-|7|circRNA|KIF13A|ENST00000378814.9|12,11,10,9,8,7,6 | circKIF13A(12,11,10,9,8,7,6) | KIF13A | MKAPELKEKLEESEKLIKELTVTWEEKLRKTEEIAQVRENPFP | KTEEIAQVR | No | Alternative | Junction | 9 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page