top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr6|158033454|158043399|+|2|circRNA|SYNJ2|NM_003898|4,5 | circSYNJ2(4,5) | SYNJ2 | MIYMDDGVSSFVQIRGSVPLFWEQPGLQEPAVARALEAAPGELL | MIYMDDGVSSFVQIRGSVPLFWEQPGLQEPAVAR | No | Junction | Junction | 34 | 1 | ATG | TGA | TransCirc | No |
chr6|158081108|158081510|+|2|circRNA|SYNJ2|NM_003898|19,20 | circSYNJ2(19,20) | SYNJ2 | LCWRSWRWKFRKSMWVLGRGFSRKCPPSRAPWMPLL | SMWVLGRGFSR | No | Alternative | Alternative | 11 | 1 | CTG | TAG | TransCirc | No |
chr6|158312213|158313605|+|1|new|TULP4|ENST00000620026|1392|0 | circTULP4(L1S) | TULP4 | LVEEQSDGALRSPGTQGQALRWKVSGSETTRRESVFLPKIWTLVCTNSGLFCTVCVPFFPFMQSFSALAAEICLVQETC | VSGSETTR | No | Alternative | Alternative | 8 | 1 | CTG | TAG | NA | No |
chr6|158448995|158489732|+|6|circRNA|TULP4|ENST00000367097.7|4,5,6,7,8,9 | circTULP4(4,5,6,7,8,9) | TULP4 | LISTVIDSCNCSDSSDIELSDDWAAKKSPKISRASKSPKLPRCCLARPMGR | CCLARPMGR | Yes | Alternative | Junction | 9 | 3 | TTG | TGA | TransCirc | No |
chr6|158452133|158461729|+|2|circRNA|TULP4|ENST00000367097.7|5,6 | circTULP4(5,6) | TULP4 | LLAVAGMERQTQLGELPNGPLLKSAMVKFYNVRGEHIFTLDTLVQMVRQHIPSQCRTSSLCSPSASPRETSA | GEHIFTLDTLVQMVR | Yes | Junction | Junction | 15 | 3 | TTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page