top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr6|154773988|154810208|+|11|circRNA|SCAF8|ENST00000367178.7|2,3,4,5,6,7,8,9,10,11,12 | circSCAF8(2,3,4,5,6,7,8,9,10,11,12) | SCAF8 | LALESVNTESDHAPAQEKERGNHHGRIQVKGEPEKGRKNDRKRDYLQLDLKH | LALESVNTESDHAPAQEKER | No | Alternative | Alternative | 20 | 3 | CTG | TAA | NA | No |
chr6|154773988|154810208|+|11|circRNA|SCAF8|ENST00000367178.7|2,3,4,5,6,7,8,9,10,11,12 | circSCAF8(2,3,4,5,6,7,8,9,10,11,12) | SCAF8 | LALESVNTESDHAPAQEKERGNHHGRIQVKGEPEKGRKNDRKRDYLQLDLKH | RDYLQLDLK | No | Alternative | Alternative | 9 | 3 | CTG | TAA | NA | No |
chr6|15496131|15497170|+|1|circRNA|JARID2|NM_004973|7 | circJARID2(7) | JARID2 | MRCGLSRRFSTSTSWAGAGAPTCSGWPASRSTSNLRASPWTSSRS | ASPWTSSR | No | Alternative | Alternative | 8 | 2 | ATG | TAG | TransCirc | No |
chr6|15496131|15497170|+|1|circRNA|JARID2|NM_004973|7 | circJARID2(7) | JARID2 | MRCGLSRRFSTSTSWAGAGAPTCSGWPASRSTSNLRASPWTSSRS | MRCGLSR | No | Alternative | Alternative | 7 | 2 | ATG | TAG | TransCirc | No |
chr6|15504499|15513422|+|8|circRNA|JARID2|NM_004973|9,10,11,12,13,14,15,16 | circJARID2(9,10,11,12,13,14,15,16) | JARID2 | LASTPPHAMAATMAAARWRTGRKSLESGCSWRRQRGGVRSASTCATCPWEGLFL | LASTPPHAMAATMAAAR | No | Alternative | Junction | 17 | 3 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page