top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr6|150955994|151037117|+|10|circRNA|MTHFD1L|ENST00000367321.7|17,18,19,20,21,22,23,24,25,26 | circMTHFD1L(17,18,19,20,21,22,23,24,25,26) | MTHFD1L | LPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTYWIQMTDFYEK | ASIGAGFIYPLVGTYWIQMTDFYEK | No | Junction | Junction | 25 | 1 | TTG | TAA | TransCirc | No |
chr6|150955994|151037117|+|10|circRNA|MTHFD1L|ENST00000367321.7|17,18,19,20,21,22,23,24,25,26 | circMTHFD1L(17,18,19,20,21,22,23,24,25,26) | MTHFD1L | LPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTYWIQMTDFYEK | DFILPISDVRASIGAGFIYPLVGTYWIQMTDFYEK | No | Junction | Junction | 35 | 1 | TTG | TAA | TransCirc | No |
chr6|151348710|151353752|+|1|circRNA|AKAP12|ENST00000402676.6|4 | circAKAP12(4) | AKAP12 | LERNRKGKEEEETRNQGSTLRFQPILRTARRSKRARALPHPLRSPRRSRVWKRA | ALPHPLR | No | Alternative | Alternative | 7 | 1 | CTG | TAG | NA | No |
chr6|151348710|151353752|+|1|circRNA|AKAP12|ENST00000402676.6|4 | circAKAP12(4) | AKAP12 | LMRKGDQKQWEETTRKLMRPEKTKRRGQTGSLLVPKNMIQGREVPPRSKLEALPKGRAFPPGSHLKG | GQTGSLLVPKNMIQGR | No | Alternative | Alternative | 16 | 1 | CTG | TAG | NA | No |
chr6|151348710|151353752|+|1|circRNA|AKAP12|ENST00000402676.6|4 | circAKAP12(4) | AKAP12 | MKGREQQGLATTRTPALGLEKQHPKKANPNNLQRNPKRP | GREQQGLATTR | No | Alternative | Alternative | 11 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page