top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|30455136|30457042|-|2|circRNA|NOD1|NM_006092|5,4 | circNOD1(5,4) | NOD1 | MPTWTSGLGCWRSASPLPCSLRAKSWSTLTQGLRRVAGALEGAA | MPTWTSGLGCWR | No | Alternative | Junction | 12 | 2 | ATG | TGA | TransCirc | No |
chr7|30455136|30457042|-|2|circRNA|NOD1|NM_006092|5,4 | circNOD1(5,4) | NOD1 | MPTWTSGLGCWRSASPLPCSLRAKSWSTLTQGLRRVAGALEGAA | VAGALEGAA | No | Alternative | Junction | 9 | 2 | ATG | TGA | TransCirc | No |
chr7|30778431|30840848|+|8|circRNA|INMT-FAM188B|NR_037598|4,5,6,7,8,9,10,11 | circINMT-FAM188B(4,5,6,7,8,9,10,11) | INMT-FAM188B | LSKAVSYRNSCLKEIAKPTVLRLKEDMCDHGPGTPTL | AVSYRNSCLK | No | Alternative | Junction | 10 | 2 | CTG | TGA | TransCirc | No |
chr7|32543140|32559464|+|9|circRNA|AVL9|NM_015060|2,3,4,5,6,7,8,9,10 | circAVL9(2,3,4,5,6,7,8,9,10) | AVL9 | LNMVSVTVLSIDPGKVCLKMVGFRKVTHVQMILFLHPLLMFHIPTWELSGKSWQETMEKMLP | LNMVSVTVLSIDPGK | No | Alternative | Alternative | 15 | 1 | TTG | TGA | NA | No |
chr7|32544693|32570154|+|9|circRNA|AVL9|NM_015060|3,4,5,6,7,8,9,10,11 | circAVL9(3,4,5,6,7,8,9,10,11) | AVL9 | MSPFGGLLLELLTSFFDNRNTSVMPLWKYCVFSLATQKWKWSHSIWYLLLSTN | NTSVMPLWKYCVFSLATQK | No | Junction | Junction | 19 | 2 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page