top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr5|79728914|79739403|+|1|circRNA|CMYA5|NM_153610|2 | circCMYA5(2) | CMYA5 | LKRKQNSGLLVQLRRKIIWKTDHIPWQKRRCWQKNKTLWPH | QNSGLLVQLR | No | Alternative | Alternative | 10 | 1 | CTG | TAG | TransCirc | No |
chr5|79728914|79739403|+|1|circRNA|CMYA5|NM_153610|2 | circCMYA5(2) | CMYA5 | LNMQFCQKKRMRNLRLIPQLQPLHLRALSHHPQLRRLQRTSLHCFQQLHQNTWSYQETRPQKVGVTHQTPHLLLNIQFHHWQQKSH | ALSHHPQLR | No | Alternative | Alternative | 9 | 1 | CTG | TGA | TransCirc | No |
chr5|79728914|79739403|+|1|circRNA|CMYA5|NM_153610|2 | circCMYA5(2) | CMYA5 | LRKRERKEFHLSNRGCPACFLDRALQITKLLNKKT | GCPACFLDRALQITK | No | Alternative | Alternative | 15 | 1 | CTG | TAG | TransCirc | No |
chr5|79728914|79739403|+|1|circRNA|CMYA5|NM_153610|2 | circCMYA5(2) | CMYA5 | LRMSKKQKWKNSLFLQRMKTGCWESQKMWLVNTNRE | MWLVNTNR | No | Alternative | Alternative | 8 | 1 | CTG | TAG | TransCirc | No |
chr5|79728914|79739403|+|1|circRNA|CMYA5|NM_153610|2 | circCMYA5(2) | CMYA5 | LSLGAEKEKKKIESFVHLLRCLQFQSFHHCLGRNLRMKKLNLSLPRSSA | LNLSLPRSSA | No | Alternative | Alternative | 10 | 1 | CTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page