top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr5|71513184|71524323|+|7|circRNA|BDP1|ENST00000358731.8|19,20,21,22,23,24,25 | circBDP1(19,20,21,22,23,24,25) | BDP1 | LPWMGKQLSLLHLSMREIVVKGEVIKSSNQMSPEVVDQNEFGVRPLRRNLELPRPCW | GEVIKSSNQMSPEVVDQNEFGVRPLR | No | Alternative | Alternative | 26 | 3 | TTG | TGA | NA | No |
chr5|71513184|71524323|+|7|circRNA|BDP1|ENST00000358731.8|19,20,21,22,23,24,25 | circBDP1(19,20,21,22,23,24,25) | BDP1 | LPWMGKQLSLLHLSMREIVVKGEVIKSSNQMSPEVVDQNEFGVRPLRRNLELPRPCW | NLELPRPCW | No | Alternative | Alternative | 9 | 3 | TTG | TGA | NA | No |
chr5|71513184|71524323|+|7|circRNA|BDP1|ENST00000358731.8|19,20,21,22,23,24,25 | circBDP1(19,20,21,22,23,24,25) | BDP1 | LPWMGKQLSLLHLSMREIVVKGEVIKSSNQMSPEVVDQNEFGVRPLRRNLELPRPCW | QLSLLHLSMREIVVK | No | Alternative | Alternative | 15 | 3 | TTG | TGA | NA | No |
chr5|71513184|71524323|+|7|circRNA|BDP1|ENST00000358731.8|19,20,21,22,23,24,25 | circBDP1(19,20,21,22,23,24,25) | BDP1 | LPWMGKQLSLLHLSMREIVVKGEVIKSSNQMSPEVVDQNEFGVRPLRRNLELPRPCW | SSNQMSPEVVDQNEFGVRPLR | No | Alternative | Alternative | 21 | 3 | TTG | TGA | NA | No |
chr5|71513184|71524323|+|7|circRNA|BDP1|ENST00000358731.8|19,20,21,22,23,24,25 | circBDP1(19,20,21,22,23,24,25) | BDP1 | LPWMGKQLSLLHLSMREIVVKGEVIKSSNQMSPEVVDQNEFGVRPLRRNLELPRPCW | SSNQMSPEVVDQNEFGVRPLRR | No | Alternative | Alternative | 22 | 3 | TTG | TGA | NA | No |
Page 1 of 1
bottom of page