top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr5|179823857|179825226|+|3|circRNA|SQSTM1|NM_001142298|4,5,6 | circSQSTM1(4,5,6) | SQSTM1 | LGRVWQLPLALWRKKSAGGTTAHRVLRRRPATWCTPM | KSAGGTTAHR | No | Alternative | Junction | 10 | 1 | TTG | TGA | TransCirc | No |
chr5|179833246|179833559|+|1|ciRNA|SQSTM1|NM_001142298|7 | ciSQSTM1(7) | SQSTM1 | LFPLDPCSLNCTCACVLPDCLPGARAMVRLGLLRVSPASLCPSRHLGPRPA | VSPASLCPSR | No | Junction | Junction | 10 | 2 | CTG | TAG | NA | No |
chr5|179833246|179833559|+|1|ciRNA|SQSTM1|NM_001142298|7 | ciSQSTM1(7) | SQSTM1 | LWPAPPPHPQHLCSPTYKPEGAAAAAVMSVPLKSRWEPARTL | WEPARTL | No | Alternative | Alternative | 7 | 2 | CTG | TAG | NA | No |
chr5|179840871|179842064|-|2|circRNA|C5orf45|ENST00000522663.5|7,6 | circC5orf45(7,6) | C5orf45 | LGTPEGKIAALRESLAEVSRKGLPRTGAGRNRSVFQQTAFIQNGGARPPLQSRPA | LGTPEGK | No | Alternative | Junction | 7 | 1 | CTG | TAG | TransCirc | No |
chr5|180248972|180269409|-|4|circRNA|MAPK9|ENST00000452135.6|6,5,4,3 | circMAPK9(6,5,4,3) | MAPK9 | LKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVLHLIQFLG | APEVILGMGYKENVLHLIQFLG | No | Junction | Junction | 22 | 1 | TTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page