top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr5|160670462|160670667|-|1|circRNA|ATP10B|ENST00000327245.9|7 | circATP10B(7) | ATP10B | MKCNEIVPADILLLFSSDPNGICHLETASLDGETNLKQRCVVKGFSQQKRADLCAEVLEGCARGRLHPNEMQ | ADLCAEVLEGCARGR | No | Alternative | Junction | 15 | 2 | ATG | TGA | TransCirc | No |
chr5|163469640|163471463|+|3|circRNA|HMMR|ENST00000353866.7|4,5,6 | circHMMR(4,5,6) | HMMR | MMAKQEGMEMKLQVTQRSLEESQGKIAQLEGKLFVFFYRNVVPRTGGSRIWKLSWKRWKQG | IAQLEGKLFVFFYR | No | Junction | Junction | 14 | 1 | ATG | TAA | TransCirc | No |
chr5|16694370|16699573|-|2|circRNA|MYO10|NM_012334|27,26 | circMYO10(27,26) | MYO10 | MKPSCGSAPSRRPSSKAGSTKKGGAPPRCPGEIGRSAGLSSASPS | KGGAPPR | No | Alternative | Alternative | 7 | 1 | ATG | TGA | TransCirc | No |
chr5|168371423|168385414|+|2|circRNA|WWC1|ENST00000265293.8|2,3 | circWWC1(2,3) | WWC1 | MLKDYLVVAQEALSAQKEIYQVKQQRLELAQQEYQQLHAVWEHKLGSQVSCTPNRSPLLTALVMSCR | LELAQQEYQQLHAVWEHKLGSQVSCTPNR | No | Junction | Junction | 29 | 3 | ATG | TAG | TransCirc | No |
chr5|168371423|168385414|+|2|circRNA|WWC1|ENST00000265293.8|2,3 | circWWC1(2,3) | WWC1 | MLKDYLVVAQEALSAQKEIYQVKQQRLELAQQEYQQLHAVWEHKLGSQVSCTPNRSPLLTALVMSCR | LGSQVSCTPNR | No | Junction | Junction | 11 | 3 | ATG | TAG | TransCirc | No |
Page 1 of 1
bottom of page