top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr5|133076653|133092789|+|7|circRNA|HSPA4|ENST00000304858.6|7,8,9,10,11,12,13 | circHSPA4(7,8,9,10,11,12,13) | HSPA4 | MLKSNSSRHQQKIRQSLKKWRFWPLHLTRHWEVENLMKC | HWEVENLMKC | No | Alternative | Junction | 10 | 2 | ATG | TAG | TransCirc | No |
chr5|133076653|133092789|+|7|circRNA|HSPA4|ENST00000304858.6|7,8,9,10,11,12,13 | circHSPA4(7,8,9,10,11,12,13) | HSPA4 | MLKSNSSRHQQKIRQSLKKWRFWPLHLTRHWEVENLMKC | WRFWPLHLTR | No | Junction | Junction | 10 | 2 | ATG | TAG | TransCirc | No |
chr5|133091192|133092789|+|2|circRNA|HSPA4|ENST00000304858.6|12,13 | circHSPA4(12,13) | HSPA4 | MQVDQEEPHVEEQQQQTPAENKAESEEMELSFQFRKSLLSLMAPVQK | SLLSLMAPVQK | No | Alternative | Junction | 11 | 1 | ATG | TGA | TransCirc | No |
chr5|134312291|134360091|-|5|circRNA|CDKL3|ENST00000265334.8|7,6,5,4,3 | circCDKL3(7,6,5,4,3) | CDKL3 | LILLTGYHLVIFCIMSILLEMDLLKTISSRKPGQSD | LILLTGYHLVIFCIMSILLEMDLLKTISSR | No | Junction | Junction | 30 | 2 | TTG | TGA | TransCirc | No |
chr5|134661118|134718173|+|19|circRNA|SEC24A|NM_021982|2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20 | circSEC24A(2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20) | SEC24A | MELSSWMQALSCPKCIAVFTRVSEPRIQFPASRILPSSNTSKDFESSLWTV | MELSSWMQALSCPK | No | Junction | Junction | 14 | 2 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page