top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr5|103136731|103146681|+|3|circRNA|PPIP5K2|ENST00000321521.13|4,5,6 | circPPIP5K2(4,5,6) | PPIP5K2 | LIEGEDHVEVNGEVFQKPFVEKPVSAEDHNVYIYYPTSAGGGSQRLFRKDFHWTKRLPMQNSGIHL | LPMQNSGIHL | No | Alternative | Junction | 10 | 3 | CTG | TAA | TransCirc | No |
chr5|108946129|109047198|+|6|circRNA|FER|NM_005246|11,12,13,14,15,16 | circFER(11,12,13,14,15,16) | FER | LHTKTACLHHYGTGFRKERRGYPNLNLFVIQLLE | TACLHHYGTGFRK | No | Junction | Junction | 13 | 1 | TTG | TAA | TransCirc | No |
chr5|109344189|109379254|-|6|circRNA|PJA2|NM_014819|9,8,7,6,5,4 | circPJA2(9,8,7,6,5,4) | PJA2 | LLVILSLSIRIARKFRGLLKMKWLVRNNKIILARKDRQNIHLKMQPVVQGIFVVNKIPMIGKRTMEVLLNR | IPMIGKR | No | Alternative | Alternative | 7 | 3 | CTG | TAG | TransCirc | No |
chr5|109344189|109379254|-|6|circRNA|PJA2|NM_014819|9,8,7,6,5,4 | circPJA2(9,8,7,6,5,4) | PJA2 | LPCHHFFHKPCVSIWLQKVPVLWIKLILLYPVNLYLKKVKQKFPLVVQH | LILLYPVNLYLK | No | Alternative | Junction | 12 | 3 | TTG | TGA | TransCirc | No |
chr5|109713519|109716264|+|2|circRNA|MAN2A1|ENST00000261483.4|2,3 | circMAN2A1(2,3) | MAN2A1 | MLDVYSLISFDNPDGGVWKQGFDITYESNEWDTEPLQVFVVPHSHNDPGPALNVARKNRPFGAFAS | QGFDITYESNEWDTEPLQVFVVPHSHNDPGPALNVAR | No | Junction | Junction | 37 | 1 | ATG | TGA | riboCIRC,TransCirc | No |
Page 1 of 1
bottom of page