top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr4|76754310|76759695|+|3|circRNA|SHROOM3|NM_020859|7,8,9 | circSHROOM3(7,8,9) | SHROOM3 | LPQATTGRNARAGHRHQGCTPDPNWHPSAFSHSLWLLLTGRSDRATASPALHPCHDAQKQWSHPDPASRSKRL | NARAGHR | No | Alternative | Alternative | 7 | 2 | CTG | TGA | TransCirc | No |
chr4|76754310|76759695|+|3|circRNA|SHROOM3|NM_020859|7,8,9 | circSHROOM3(7,8,9) | SHROOM3 | MLVNCPAYYSVSAPKAELLNKIKEMPAEVNEEEEQADVNEKKVTQLFRKRPRRDAAALPPSHPSLGWFRLQSHW | DAAALPPSHPSLGWFR | No | Alternative | Junction | 16 | 2 | ATG | TGA | TransCirc | No |
chr4|76754310|76759695|+|3|circRNA|SHROOM3|NM_020859|7,8,9 | circSHROOM3(7,8,9) | SHROOM3 | MLVNCPAYYSVSAPKAELLNKIKEMPAEVNEEEEQADVNEKKVTQLFRKRPRRDAAALPPSHPSLGWFRLQSHW | DAAALPPSHPSLGWFRLQSHW | No | Alternative | Junction | 21 | 2 | ATG | TGA | TransCirc | No |
chr4|76754310|76759695|+|3|circRNA|SHROOM3|NM_020859|7,8,9 | circSHROOM3(7,8,9) | SHROOM3 | MLVNCPAYYSVSAPKAELLNKIKEMPAEVNEEEEQADVNEKKVTQLFRKRPRRDAAALPPSHPSLGWFRLQSHW | VTQLFRK | No | Alternative | Junction | 7 | 2 | ATG | TGA | TransCirc | No |
chr4|76770625|76770898|+|1|circRNA|SHROOM3|NM_020859|10 | circSHROOM3(10) | SHROOM3 | LRMSLAALVKMPVMKKGLSSLEVSPTSWRPSRRRRGACSRTSSSTTPWEKRWRL | GLSSLEVSPTSWRPSR | No | Junction | Junction | 16 | 2 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page