top of page
Circular RNA Associated Neoantigens (CRANS)
Use criteria below to search among 914 CRANS:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Neoantigen | Kmer Length | CircRNA Input Peptide | Gene | Oncogenic Driver | Passing Algorithms | No. of Passing Algorithms | Best Combined HLA Alleles |
|---|---|---|---|---|---|---|---|---|---|
chr7|151074053|151074250|1|197|0 | NA | MAGTFFIAF | 9 | SLAGQSGQGKPRGQPNTALLSLVLMAGTFFIAFPCMAAQPPTAQR | SLC4A2 | No | HLAthena | 1 | HLA-C*03:02 |
chr7|151074053|151074250|1|197|0 | NA | VLMAGTFFI | 9 | SLAGQSGQGKPRGQPNTALLSLVLMAGTFFIAFPCMAAQPPTAQR | SLC4A2 | No | MHCflurry,MHCnuggetsI,NetMHC,NetMHCcons,NetMHCpan,PickPocket,SMM,SMMPMBEC | 8 | HLA-A*02:01 |
chr7|151074053|151074250|1|197|0 | NA | KPRGQPNTAL | 10 | SLAGQSGQGKPRGQPNTALLSLVLMAGTFFIAFPCMAAQPPTAQR | SLC4A2 | No | HLAthena | 1 | HLA-B*07:02 |
chr7|156826604|156836885|3|25,62,77|0,7126,10204 | circLMBR1(S1,NE,NE) | MPSSTGFRM | 9 | MPSSTGFRMYFK | LMBR1 | No | MHCflurry,MHCnuggetsI,NetMHC,NetMHCcons,NetMHCpan,PickPocket,SMM,SMMPMBEC | 8 | HLA-B*35:01 |
chr7|156826604|156836885|3|25,62,77|0,7126,10204 | circLMBR1(S1,NE,NE) | STGFRMYFK | 9 | MPSSTGFRMYFK | LMBR1 | No | HLAthena | 1 | HLA-A*11:01 |
Page 1 of 1
bottom of page