top of page
Circular RNA Associated Neoantigens (CRANS)
Use criteria below to search among 914 CRANS:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Neoantigen | Kmer Length | CircRNA Input Peptide | Gene | Oncogenic Driver | Passing Algorithms | No. of Passing Algorithms | Best Combined HLA Alleles |
|---|---|---|---|---|---|---|---|---|---|
chr5|31421271|31424471|3|106,158,45|0,1515,3155 | circDROSHA(NE,S1S,2S) | ILIDNLLK | 8 | SGSIILSTHSNYKSQILIDNLLK | DROSHA | Yes | HLAthena | 1 | HLA-A*03:01 |
chr5|31421271|31424471|3|106,158,45|0,1515,3155 | circDROSHA(NE,S1S,2S) | THSNYKSQIL | 10 | SGSIILSTHSNYKSQILIDNLLK | DROSHA | Yes | HLAthena | 1 | HLA-B*39:05 |
chr5|31421271|31424471|3|106,158,45|0,1515,3155 | circDROSHA(NE,S1S,2S) | ILIDNLLK | 8 | SQILIDNLLK | DROSHA | Yes | HLAthena | 1 | HLA-A*03:01 |
chr5|31421271|31424471|3|106,158,45|0,1515,3155 | circDROSHA(NE,S1S,2S) | LQFYKNLLSL | 10 | LLQFYKNLLSLK | DROSHA | Yes | MHCflurry,MHCnuggetsI,NetMHC,NetMHCcons,NetMHCpan,PickPocket,SMM,SMMPMBEC | 8 | HLA-A*02:06 |
chr5|31421271|31424471|3|77,143,45|0,1530,3155 | circDROSHA(NE,S1S,2S).B | ATEYLFIHF | 9 | LWDCDSIMQLVATEYLFIHFPDHHEGHLTDLR | DROSHA | Yes | HLAthena | 1 | HLA-A*01:01 |
Page 1 of 1
bottom of page