top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|23044426|23050520|3|60,104,49|0,2122,6045 | circKDM1A(S1,NE,NE) | KDM1A | LSSHLPLPLFLLLINGPQQTQKVFLFIRNRTGKQEDFKTTVLEGMETAKHQSRCYLYLTRIKRK | TTVLEGMETAKHQSR | No | Alternative | Junction | 15 | 1 | CTG | TGA | NA | Yes |
chr1|235054920|235055096|1|176|0 | circT033420(S1L) | T033420 | MLEGFPAVPCSGLAFERLQAGGGKVAEAGPRSLRAPQRTLWVH | LQAGGGK | No | Alternative | Alternative | 7 | 1 | ATG | TAG | NA | No |
chr1|235054920|235055096|1|176|0 | circT033420(S1L) | T033420 | MLEGFPAVPCSGLAFERLQAGGGKVAEAGPRSLRAPQRTLWVH | LQAGGGKVAEAGPR | No | Alternative | Alternative | 14 | 1 | ATG | TAG | NA | Yes |
chr1|235054920|235055096|1|176|0 | circT033420(S1L) | T033420 | MLEGFPAVPCSGLAFERLQAGGGKVAEAGPRSLRAPQRTLWVH | MLEGFPAVPCSGLAFER | No | Alternative | Alternative | 17 | 1 | ATG | TAG | NA | Yes |
chr1|235054920|235055096|1|176|0 | circT033420(S1L) | T033420 | MLEGFPAVPCSGLAFERLQAGGGKVAEAGPRSLRAPQRTLWVH | VAEAGPR | No | Alternative | Alternative | 7 | 1 | ATG | TAG | NA | No |
Page 1 of 1
bottom of page