top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr22|30341346|30341661|2|175,60|0,255 | circENST00000444440(NE,NE).A | ENST00000444440 | LFCGRLPGPDSLLSLPRASPQGTHCITLFCFELSAGLQAPRAFPLKPQEVEVLSTSQIQLPSPATKIHS | LPGPDSLLSLPR | No | Alternative | Junction | 12 | 1 | CTG | TAG | NA | Yes |
chr22|30409408|30409584|1|176|0 | circSEC14L2(L2L) | SEC14L2 | LFPQFLCMFEENYPETLKRLFVVKGKLGISCDKARWKRGVKNMTAADGGSNSEPKEG | GVKNMTAADGGSNSEPK | No | Alternative | Alternative | 17 | 3 | TTG | TGA | NA | No |
chr22|30409408|30409584|1|176|0 | circSEC14L2(L2L) | SEC14L2 | LFPQFLCMFEENYPETLKRLFVVKGKLGISCDKARWKRGVKNMTAADGGSNSEPKEG | NMTAADGGSNSEPK | No | Alternative | Alternative | 14 | 3 | TTG | TGA | NA | No |
chr22|31810520|31815212|2|103,40|0,4652 | circDEPDC5(NE,S1) | DEPDC5 | LPGPSRAHMKSAAPWDTPALELSGVQKNLRTPFPSK | SAAPWDTPALELSGVQK | No | Junction | Junction | 17 | 3 | CTG | TAG | TransCirc | Yes |
chr22|36322428|36327488|3|93,94,28|0,4139,5032 | circMYH9(NE,NE,NE) | MYH9 | LVNLELARRRTPRRSSSIWRTWRPRTRARRTRASWSGSCCRPTPSWRPSGTPRP | LVNLELAR | No | Alternative | Junction | 8 | 1 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page