top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr19|47362475|47362693|1|218|0 | circDHX34(NE) | DHX34 | MPNRTMMPSPPTPSQKFGGWPWTRWCCRKGEGDELRSAGQAATAAGVLD | MPNRTMMPSPPTPSQK | No | Alternative | Junction | 16 | 1 | ATG | TAG | riboCIRC,TransCirc | Yes |
chr19|47362475|47362693|1|218|0 | circDHX34(NE) | DHX34 | MPNRTMMPSPPTPSQKFGGWPWTRWCCRKGEGDELRSAGQAATAAGVLD | SAGQAATAAGVLD | No | Alternative | Junction | 13 | 1 | ATG | TAG | riboCIRC,TransCirc | Yes |
chr19|47362475|47362693|1|218|0 | circDHX34(NE) | DHX34 | MPNRTMMPSPPTPSQKFGGWPWTRWCCRKGEGDELRSAGQAATAAGVLD | TMMPSPPTPSQK | No | Alternative | Junction | 12 | 1 | ATG | TAG | riboCIRC,TransCirc | Yes |
chr19|47362475|47362693|1|218|0 | circDHX34(NE) | DHX34 | MPNRTMMPSPPTPSQKFGGWPWTRWCCRKGEGDELRSAGQAATAAGVLD | TMMPSPPTPSQKFGGWPWTR | No | Alternative | Junction | 20 | 1 | ATG | TAG | riboCIRC,TransCirc | Yes |
chr19|47362475|47362693|2|47,81|0,137 | circDHX34(NE,NE).A | DHX34 | MMPSPPTPSQKFGGWPWTRWCCRKGEGDELRSAGQAATGRIGL | GEGDELRSAGQAATGR | No | Alternative | Junction | 16 | 1 | ATG | TGA | riboCIRC,TransCirc | No |
Page 1 of 1
bottom of page