top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr18|37066867|37084232|3|48,35,108|0,643,17257 | NA | KIAA1328 | MAVTLDQGDLVVLSRYPVEKALSTAASPVSTGLQLVKSSGSV | ALSTAASPVSTGLQLVKSSGSV | Yes | Alternative | Junction | 22 | 2 | ATG | TAA | NA | Yes |
chr18|42015475|42029441|2|91,84|0,13882 | circPIK3C3(NE,S3) | PIK3C3 | LELAAQQTFVDRLVHLMKAVQRESGNRKKKLPNYNQPPSFSLFTSSCIKNKRSSRWRKSGTGCTTDICRSVGASNEGSTTRKWKS | SVGASNEGSTTR | No | Alternative | Junction | 12 | 2 | CTG | TAA | TransCirc | No |
chr18|49929511|49937397|2|100,46|0,7840 | circMYO5B(NE,NE) | MYO5B | LTCFMMTRTLFSPLAALTQREQCSNSEPAGCWRRFESVQLATHPVPTSG | LTCFMMTR | No | Alternative | Junction | 8 | 2 | CTG | TGA | TransCirc | No |
chr18|49929511|49937397|2|62,42|0,7844 | circMYO5B(NE,NE).B | MYO5B | LTCFMMTRTLNSEPAGCWRRFESVQLATHPVPTSG | LTCFMMTRTLNSEPAGCWR | No | Alternative | Junction | 19 | 2 | CTG | TGA | TransCirc | Yes |
chr18|49929511|49937397|2|62,42|0,7844 | circMYO5B(NE,NE).B | MYO5B | LTCFMMTRTLNSEPAGCWRRFESVQLATHPVPTSG | TLNSEPAGCWRR | No | Alternative | Junction | 12 | 2 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page