top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr16|74912197|74916259|3|165,125,133|0,3672,3929 | circWDR59(NE,NE,NE) | WDR59 | MVLMSSLRVFPFCRNLRRPCTLKIQITSTLQAMGRKKP | MVLMSSLR | No | Alternative | Junction | 8 | 2 | ATG | TAA | NA | No |
chr16|76539718|76553907|5|134,88,68,46,72|0,984,13564,13737,14117 | circCNTNAP4(NE,NE,NE,S1,2) | CNTNAP4 | MWTRILHWQVRRASQAASLHLALMPHQGKGHTRLQIILEQ | ASQAASLHLALMPHQGK | No | Alternative | Junction | 17 | 1 | ATG | TAG | TransCirc | Yes |
chr16|77198346|77198548|1|202|0 | circMON1B(NE) | MON1B | LSTLEMCVGVCLWPVIVSLSNGARSEGPPMREMVAAARRAGCFPCPVMHLPLWGNP | EMVAAAR | No | Alternative | Alternative | 7 | 2 | CTG | TAG | NA | No |
chr16|77198346|77198548|1|202|0 | circMON1B(NE) | MON1B | LSTLEMCVGVCLWPVIVSLSNGARSEGPPMREMVAAARRAGCFPCPVMHLPLWGNP | EMVAAARR | No | Alternative | Alternative | 8 | 2 | CTG | TAG | NA | No |
chr16|77198346|77198548|1|202|0 | circMON1B(NE) | MON1B | LSTLEMCVGVCLWPVIVSLSNGARSEGPPMREMVAAARRAGCFPCPVMHLPLWGNP | SEGPPMR | No | Alternative | Alternative | 7 | 2 | CTG | TAG | NA | No |
Page 1 of 1
bottom of page