top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr15|76287845|76292700|3|100,83,82|0,4585,4773 | circETFA(L1L,NE,3S) | ETFA | LVAQHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKLEVAPISDIIAIKSPDTFVRTIYAGGTRSL | SPDTFVRTIYAGGTR | Yes | Junction | Junction | 15 | 1 | CTG | TAA | riboCIRC,TransCirc | Yes |
chr15|80120327|80122800|3|130,93,101|0,1400,2372 | circZFAND6(3S,S4,5) | ZFAND6 | LAVDFMETLVQMACVQYAIKNIFCLNLYQFNAQMAVCQKPSQH | LAVDFMETLVQMACVQYAIK | No | Alternative | Junction | 20 | 1 | CTG | TAG | riboCIRC | Yes |
chr15|80120327|80122800|3|130,93,101|0,1400,2372 | circZFAND6(3S,S4,5) | ZFAND6 | MHRWQCARSPVSIRLYIFIYAAQPCIKSVTFIRICSIFSIGQYICGQSST | WQCARSPVSIR | No | Alternative | Junction | 11 | 2 | ATG | TGA | NA | Yes |
chr15|80120327|80122800|3|49,38,101|0,1455,2372 | circZFAND6(3S,S4,5).A | ZFAND6 | MQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDVQGVQLRNMAQETNHSQVPQH | AVPETEDVQGVQLRNMAQETNHSQVPQH | No | Junction | Junction | 28 | 2 | ATG | TAG | riboCIRC,TransCirc | Yes |
chr15|80837855|80838053|1|198|0 | circENST00000385268(NE) | ENST00000385268 | LGGLLHTAHLGQPEGQSGKCIGRSPWEKGCSHLRWVNKEVGVASGGHRGKQ | WVNKEVGVASGGHR | No | Alternative | Alternative | 14 | 3 | CTG | TGA | NA | No |
Page 1 of 1
bottom of page