top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr15|59208680|59208848|1|168|0 | circMYO1E(1L) | MYO1E | MTCAPRCMRWVRGQIRRCSRNFRCRLGVMSTSTVGTKASSFIIMLGRTLLAS | ASSFIIMLGRTLLAS | No | Junction | Junction | 15 | 2 | ATG | TGA | NA | Yes |
chr15|65581953|65595825|3|66,87,93|0,11532,13779 | circINTS14(NE,NE,NE) | INTS14 | MRWVLASLMTMKMKIQPIRLQAKYPTFTDVQKILRNARKLPEKTQTFYKIWK | WVLASLMTMKMK | Yes | Alternative | Junction | 12 | 1 | ATG | TAG | TransCirc | Yes |
chr15|67124714|67124877|1|163|0 | circENST00000540846(NE) | ENST00000540846 | LKNLSALCLNEGHLEGLEEKMWHRAAGERLVARRWT | NLSALCLNEGHLEGLEEKMWHR | No | Alternative | Alternative | 22 | 1 | TTG | TGA | NA | Yes |
chr15|67190590|67190788|1|198|0 | NA | SMAD3 | LKHTSKPRGGCYEQLCLPNTFTLWPHFEGQEMASALVEKIGTLLNPLLSRKKKSFSLN | IGTLLNPLLSRK | No | Alternative | Junction | 12 | 1 | CTG | TGA | NA | Yes |
chr15|68141945|68173892|3|85,105,77|0,344,31870 | circPIAS1(NE,NE,NE) | PIAS1 | MNEKKPTWVCPVCDKKAPYEHLIIDGIRQQSALSRNLFCICLDTTTSAANQ | QQSALSR | Yes | Alternative | Junction | 7 | 2 | ATG | TAG | TransCirc | No |
Page 1 of 1
bottom of page