top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr11|70354300|70356254|2|42,71|0,1883 | circPPFIA1(NE,S2) | PPFIA1 | MTRQPHLRMPWDLANWGDRLKKIVNFKKIATFQRRGTR | MPWDLANWGDR | Yes | Alternative | Junction | 11 | 2 | ATG | TGA | TransCirc | Yes |
chr11|70354300|70356254|2|42,71|0,1883 | circPPFIA1(NE,S2) | PPFIA1 | MTRQPHLRMPWDLANWGDRLKKIVNFKKIATFQRRGTR | MTRQPHLR | Yes | Alternative | Junction | 8 | 2 | ATG | TGA | TransCirc | Yes |
chr11|70354300|70356254|2|42,71|0,1883 | circPPFIA1(NE,S2) | PPFIA1 | MTRQPHLRMPWDLANWGDRLKKIVNFKKIATFQRRGTR | QPHLRMPWDLANWGDR | Yes | Alternative | Junction | 16 | 2 | ATG | TGA | TransCirc | Yes |
chr11|70354300|70362488|2|61,28|0,8160 | circPPFIA1(NE,S2S) | PPFIA1 | LPPSREEVRDDKTTIKCETSPRLPRPHLERCHLPEKRYEMTRQP | LPRPHLER | No | Alternative | Junction | 8 | 1 | TTG | TAA | NA | No |
chr11|70354300|70362488|2|61,28|0,8160 | circPPFIA1(NE,S2S) | PPFIA1 | LPPSREEVRDDKTTIKCETSPRLPRPHLERCHLPEKRYEMTRQP | TTIKCETSPR | No | Alternative | Junction | 10 | 1 | TTG | TAA | NA | Yes |
Page 1 of 1
bottom of page