top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|77988241|78040733|+|ATP7A|ENST00000341514.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9752

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

SIASQVSLEEK

Amino Acids from 5' Exons

VSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPDPLPVLTDTLFLTVTASLTLPWDHIQSTLLKTKGVTDIKIYPQKRTVAVTIIPSIVNANQIKELVPELSLDTGTLEKKSGACEDHSMAQAGEVVLKMKVEGMTCHSCTSTIEGKIGKLQGVQRIK,YHWKKKMQLLFMTLNYRLQRPYRKLLMTWALMLLSIILTLSLFLTPCFLLRRHLCHGTISKAHCRPRVQTLKFTLRKELQQSLLMPIRKSWFQNSVILGHWRKSQELVKIIVWLKLVKSCRKWKGPAIHVLALLKEKLGNCKVFSELK,ITGRKKCNYYLPTTDSKDPTGSYHGLCCYPSPSPCFNHLVSDCYGVTDFAMGPYPKHIAEDQGCDRHNLPSEKNCSSDNNPFYSECQSDKRAGSRTQFRYWDTGEKVRSLRSYGSSWSRAEDESGRDDLPFMYHYRKNWETARCSAN

Amino Acids from 3' Exons

MSCVAPLQTQSLKQNWLSIFNLWAKFLETTVKQLDLLLL,AVWLDSHCRHSEASRTGYPYSEIYGLRSSSDDWRQQNSIYCFS,ELCGLIAIADTVKPEAELAIHILKSMGLEVVLMTGDNSKTARSIASQ

bottom of page